Protein Info for Echvi_2535 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13432: TPR_16" amino acids 37 to 93 (57 residues), 24.2 bits, see alignment E=2.2e-08 amino acids 105 to 161 (57 residues), 27.3 bits, see alignment E=2.3e-09 amino acids 173 to 234 (62 residues), 16.1 bits, see alignment E=7.8e-06 PF13414: TPR_11" amino acids 44 to 77 (34 residues), 34.2 bits, see alignment 9.6e-12 amino acids 74 to 113 (40 residues), 32.6 bits, see alignment 3.2e-11 PF00515: TPR_1" amino acids 65 to 98 (34 residues), 35.9 bits, see alignment 2.7e-12 PF13181: TPR_8" amino acids 66 to 95 (30 residues), 23.4 bits, see alignment (E = 2.7e-08) amino acids 134 to 161 (28 residues), 18.6 bits, see alignment (E = 9.5e-07) PF07719: TPR_2" amino acids 66 to 96 (31 residues), 24.8 bits, see alignment (E = 9.5e-09)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G190 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Echvi_2535 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MISSKKLLKFLFPTLTVFILLSSCDSNEDKKGRFLLKGNNKMMENDFDGAIDFYSEALAL
DQEFVDAYYNRGIAYTKTSDFQRAISDFNKAISIDHQYVDAYYHRGIAHFDNGANYNALS
DADQLIALAPDDYRGYFLRGLVQETLGNYETALQAFDQAIEHDQTITDLYVNKATIQYYR
KDYKSATTNLNKAESLNPEEPNIFNLRSLIAFERDAIDSALKWVNKAIDLNAGQAYFYNN
RGLYYLFDGQMERGIEDINFSLKQNSKNLFALRNKGIYYYLSGNKPLAIKYLQEVYSKDS
SIKLTKKYLDLAQEM