Protein Info for Echvi_2516 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: imidazoleglycerol phosphate synthase, cyclase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit
  • amino acids 1 to 250 (250 residues), 358.2 bits, E=1.1e-111
• PF00977: His_biosynth
  • amino acids 5 to 233 (229 residues), 275.1 bits, E=6.5e-86
• PF01207: Dus
  • amino acids 33 to 118 (86 residues), 21.6 bits, E=1.7e-08

Best Hits

Swiss-Prot: 72% identical to HIS6_CYTH3: Imidazole glycerol phosphate synthase subunit HisF (hisF) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 74% identity to mtt:Ftrac_3209)

MetaCyc: 58% identical to imidazole-glycerol-phosphate synthase cycloligase subunit (Thermotoga maritima)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.- or 4.3.2.10

Sequence Analysis Tools

See L0FZN0 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Echvi_2516 imidazoleglycerol phosphate synthase, cyclase subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MLTKRIIPCLDIKEGRTVKGVNFVDLRDAGDPVELAKVYSDEGADELVFLDITATVDKRK
TLAELVTRVAKAINIPFTVGGGISTVEDVKVLLNAGADKISINSAAVKRPEVIDEMAAEF
GSQCIVVAIDTRNVDGVDLVHTHGGRKPTTLQTQAWAKEVADRGAGEILLTSMDHDGTKA
GFADGLTSEISAALTIPVIASGGAGTMPHFKSVFTAGKADAALAASIFHFKEIGIPALKH
YLAGEGVTMRI