Protein Info for Echvi_2466 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08534: Redoxin
  • amino acids 42 to 99 (58 residues), 28 bits, E=2.7e-10
• PF00578: AhpC-TSA
  • amino acids 43 to 131 (89 residues), 27.2 bits, E=5e-10
• PF00255: GSHPx
  • amino acids 44 to 149 (106 residues), 141.1 bits, E=1.4e-45

Best Hits

Swiss-Prot: 40% identical to GPX4_CITSI: Probable phospholipid hydroperoxide glutathione peroxidase (CSA) from Citrus sinensis

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 62% identity to sli:Slin_0040)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.9

Sequence Analysis Tools

See L0G094 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Echvi_2466 Glutathione peroxidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRQLIFILSIVAFAACSAESNDKTNGTVEATSQNQEAMQTTKSFYDFTVKDIDGNEVNLS
KFKGQKVLVVNVASKCGYTPQYEDLQKLNEEYGDKITILGFPANNFGGQEPGSNEEIKKF
CTGNYGVTFPMFEKVSVKGVDKHPLYRWLSDKSQNGWNDQEPTWNFCKYYIDENGELKHF
FQSAVNPMDEEIIKVIES