Protein Info for Echvi_2457 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: histidinol-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01261: histidinol-phosphatase" amino acids 2 to 153 (152 residues), 178.4 bits, see alignment E=1.1e-56 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 3 to 145 (143 residues), 110 bits, see alignment E=1.5e-35 TIGR01662: HAD hydrolase, family IIIA" amino acids 3 to 145 (143 residues), 67.4 bits, see alignment E=2.2e-22 PF08645: PNK3P" amino acids 3 to 121 (119 residues), 27.8 bits, see alignment E=2.9e-10 PF13242: Hydrolase_like" amino acids 104 to 156 (53 residues), 26.6 bits, see alignment 7e-10 PF00475: IGPD" amino acids 203 to 344 (142 residues), 203.5 bits, see alignment E=2.4e-64

Best Hits

Swiss-Prot: 66% identical to HIS7_BACTN: Histidine biosynthesis bifunctional protein HisB (hisB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01089, imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC: 3.1.3.15 4.2.1.19] (inferred from 72% identity to lby:Lbys_0035)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15) / Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 3.1.3.15, EC 4.2.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15 or 4.2.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXR4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Echvi_2457 histidinol-phosphatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVLFIDRDGTIIKEPPVDYQVDSLEKLEFYPKAISNLRKIAEETDYELVMVTNQDGLG
TDSFPEDTFWPAQYKMLKTLEEEGVVFSAIHIDKTFEHENAPTRKPRTGLLTDYLKGDYD
LAHSFVIGDRKTDVQLAKNLGTQAIFIGEEAAEGAALSTTSWDEIYEFLRLPSRIGQVKR
STSETQIEIMVNLDGSGKCQIDTGLPFFDHMLEQLGKHGGTDLDIKVNGDLHIDEHHTIE
DTALALGEAYLKALGDKKGIYRYGFLLPMDDVLAQVAIDFGGRPWMMWEAEFNREKIGDM
PTEMFYHFFKSFSDTAKCNLNIKAEGANEHHKIEAIFKGLARAIKMAVKRDIAALNQLPS
TKGVL