Protein Info for Echvi_2414 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: alpha-1,2-mannosidase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 29 to 736 (708 residues), 666.6 bits, see alignment E=2e-204 PF17678: Glyco_hydro_92N" amino acids 35 to 269 (235 residues), 289.3 bits, see alignment E=2.9e-90 PF07971: Glyco_hydro_92" amino acids 275 to 736 (462 residues), 581.6 bits, see alignment E=1.3e-178

Best Hits

KEGG orthology group: None (inferred from 58% identity to sli:Slin_3892)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0Y1 at UniProt or InterPro

Protein Sequence (744 amino acids)

>Echvi_2414 alpha-1,2-mannosidase, putative (Echinicola vietnamensis KMM 6221, DSM 17526)
MGLAIGLGAVVSGCKEQAPSDQDKDRVPEADLVEYVNPYIGSGGHGHVFVGANVPFGGVQ
LGPVNLTEGWDWCSGYHYSDSTIIGFAHTHLSGTGIGDLGDVLVMPVVGEVSVAKGVPEQ
PETGYFSYFDHENEVVEAGYYAVQLDRYDVYAELTATSRAGFHQYTFPESDESKLLFNLK
QGIGWDVPTETHIELVNDTTLTGYRFSKGWAKDQKLYFAAKLSKPVVSFEVFDENEPVAG
KSLTGKEVKALMEFATTADEKVLLKVGISPVSVVNAMDNLKEEIPHWDFKRTVADAKSNW
NHELNKIQVEMDDEVEMTKFYTALYHTMIAPSVFNDHNGDYAGADGKVRNDTTFTNLTTF
SLWDIYRGCSPLYTIFQQNRMEDIVKSMLKIYEQQGKLPVWHLVGNETNTMPGYSAVPIV
VDAYLKGIPMDTVLAYEAVKASAMRDELGLDKVKELGYIPADGEVESVSKGLEYALSDWC
IAQMAKGFGAQEDVAYFSKRGKYYQHYFDPNVGFMRGRIADNEWRKPFSPFTSIHMKGDF
TEGNAWQYTWLVPQDVEGLVELLGGREAFISKLDSLFLVEGDMGEEASNDITGLVGQYAQ
GNEPSHHVTYLYGYVGQSHKTAEKVRYILKNLYANDPDGLSGNEDVGQMSAWLVLSSLGF
YPVEPAGGKYVWGSPTVNNATIRMDNGKTLHLTVKGNSEENIYIQNITFNGKPYSSQFLM
HEDLLKGGEIVVEMGSEAAEHRLK