Protein Info for Echvi_2393 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR00628: uracil-DNA glycosylase" amino acids 7 to 214 (208 residues), 291.4 bits, see alignment E=2.3e-91 PF03167: UDG" amino acids 50 to 211 (162 residues), 59.3 bits, see alignment E=2.3e-20

Best Hits

Swiss-Prot: 69% identical to UNG2_BACFN: Uracil-DNA glycosylase 2 (ung2) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 69% identity to bfr:BF3816)

MetaCyc: 56% identical to uracil-DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2584 [EC: 3.2.2.27]

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0W6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Echvi_2393 uracil-DNA glycosylase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNVKIASSWKEKLSDEFEKPYFDSLAAFVKSEYQQKQVYPAGGEIFNAFDHCPFDKVKVV
ILGQDPYHGPGQAHGLSFSVREGVPFPPSLLNIFKELKQDLGVDIPSHGNLERWAAQGVL
LLNSTLTVEAHKAGSHQKRGWEEFTDAVISKLAEEREGLVFLLWGAYARKKAAFISDQKH
LKLHAPHPSPLSAHRGFLGCGHFSKANDYLRQRGMTPINW