Protein Info for Echvi_2364 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: magnesium Mg(2+) and cobalt Co(2+) transport protein (corA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 282 to 302 (21 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 47 to 340 (294 residues), 290 bits, see alignment E=1.3e-90 PF01544: CorA" amino acids 50 to 335 (286 residues), 229 bits, see alignment E=4.2e-72

Best Hits

Swiss-Prot: 42% identical to CORA_THEMA: Cobalt/magnesium transport protein CorA (corA) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 42% identity to mmh:Mmah_1504)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ94 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Echvi_2364 magnesium Mg(2+) and cobalt Co(2+) transport protein (corA) (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKTNDKPDSLTPKPILELYSFGEQHFEKHLIQDLDALKPFLEKKDLKFWLNISSIHDSN
LILEIADLLSIHPMVIEDITNTSQRPKIEEFDDHIFVLVKMLYSKNSISEIQTEQVSILF
GQNYILSFQETPQDIFDNVRIRLENPKGKMRKLGSDYFTYVLVDAIIDEYFGILELISDT
VEKYDDQILQNKSNINLNTIHHQRKTLRRIRSSIWPLRELISIWKKSEHPLIKRKNMTYI
NDIYEHTIEILEGLELQRETMNSLAELYMTQLSIKQNEVMKTLTVIATIFIPLTFIAGIY
GMNFKFMPELEWKYSYPTLWLIFILITVMMIRYFKQKKWF