Protein Info for Echvi_2354 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 339 to 365 (27 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 244 (224 residues), 112.9 bits, see alignment E=2.7e-36 PF02687: FtsX" amino acids 294 to 407 (114 residues), 85 bits, see alignment E=4.3e-28

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 50% identity to lby:Lbys_1337)

Predicted SEED Role

"ABC transporter efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ86 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Echvi_2354 ABC-type antimicrobial peptide transport system, permease component (Echinicola vietnamensis KMM 6221, DSM 17526)
MELLENIKEALRSIKSNRLRTILTGLIIAIGITALVGMLTAIDGMKAQIEESFSGLGANN
FDVRSKNTSGQRVTRSGVTEKQFKPVSYKDALDFRKGYSSRGMATVSTRVSGSTEVKRGS
EITNPNVRIIGVDENYVLIKGQNIEEGRNFSNVEIEYGNNVCLIGSEIVELLFKSHENPV
GAYVSFFGNRYSIVGVLEEQGSVGNDSGVDRTILIPVENASRLDQTGGFWYTITVSTSDP
TKMEYEMGQATGLMRKVREDRVGELDSFEVVKSNNVGESLEEVAGYLRIGGFGIGFITLL
GASVGLMNIMLVSVTERTREIGIRKALGATPKRIRQQFLIEAIVICIMGGVFGVLVGMGI
GNIVASFVGPGGFLVPWLWMLLAFMICVLVGLVSGVIPAIKASKLDPIEALRYE