Protein Info for Echvi_2345 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: isochorismate synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR00543: isochorismate synthase" amino acids 121 to 393 (273 residues), 224.9 bits, see alignment E=8.8e-71 PF00425: Chorismate_bind" amino acids 139 to 391 (253 residues), 206.2 bits, see alignment E=3.4e-65

Best Hits

Predicted SEED Role

"Isochorismate synthase (EC 5.4.4.2) @ Menaquinone-specific isochorismate synthase (EC 5.4.4.2)" (EC 5.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZZ3 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Echvi_2345 isochorismate synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MQTTTARPYLITQEEILDRWLYRALEGGFQIAIWRAPKSNSIQLILDQTKVIKRVNLELE
TLPQGFIAHPFADQEDQKALFLEASDYYKFDLANPATDSEEEWFQKTTLPPEQLKKQVNR
FLRSAQPEKDCASSASTAKSSFIALVEEGIRAIQAGELSKVVPARIQKVHLREDFDLAKT
FLELCTLYPDAFVNFFHIPKVGTWLGATPEILIKTEGPYFQTMALAGTQKAEGENPVKNA
AWKQKEIEEQAMVSRYIVNNFKKIRLREYEENGPKTVQAGNLLHLRSDFRVNMDATNFPQ
LGSVMLKLLHPTSAVCGTPRETSMKFILDHESFDRCFFAGFIGPVNIENQTAIYVNLRTA
QLINEEVLLYAGAGVTADSIPEREWEETSLKCDIIGKFIQ