Protein Info for Echvi_2344 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02776: TPP_enzyme_N
  • amino acids 9 to 119 (111 residues), 66.4 bits, E=3.1e-22
• TIGR00173: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
  • amino acids 9 to 427 (419 residues), 394 bits, E=5.6e-122
• PF16582: TPP_enzyme_M_2
  • amino acids 212 to 388 (177 residues), 39.7 bits, E=7e-14
• PF02775: TPP_enzyme_C
  • amino acids 405 to 536 (132 residues), 23.7 bits, E=5.4e-09

Predicted SEED Role

"2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 2.2.1.9)

MetaCyc Pathways

• superpathway of menaquinol-8 biosynthesis I (9/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (8/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (6/7 steps found)
• superpathway of menaquinol-10 biosynthesis (8/10 steps found)
• superpathway of menaquinol-11 biosynthesis (8/10 steps found)
• superpathway of menaquinol-12 biosynthesis (8/10 steps found)
• superpathway of menaquinol-13 biosynthesis (8/10 steps found)
• superpathway of menaquinol-6 biosynthesis (8/10 steps found)
• superpathway of menaquinol-7 biosynthesis (8/10 steps found)
• superpathway of menaquinol-9 biosynthesis (8/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (7/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (7/9 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.9

Use Curated BLAST to search for 2.2.1.9

Sequence Analysis Tools

See L0FZ78 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Echvi_2344 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MIIQPIIDLAAIFARKGIKNAILSPGSRCAPLTLAFVRHPDIHCRTISDERSAAFVALGM
AQQLKKPVVLVCSSGTAALNYAPAIAEAFFQQIPLIVLTADRPPEWIDQWDGQTIRQQAI
YGRHIKQSYDFPDHFGHPDITWHAHRIGNEAVNEATGFPAGPVHVNIPIREPFYPESQDE
FDFNRPIPIVNKLESATHLSSSALANFKNELARFKRVVIIPGQQASHQHTLDLLNELATQ
HKVVIISDTISNMQSSNTITFHDQLLPVVDHGAFSPDLIISFGKSIISKPLKNFLRSSGA
EHWHIQPAGYSPDTYQGLAKIIPSTAQEILRILVESTLTLDGEFHQRWHQADQAMERALK
NTLEKAPFGEWKAIYNVLNHLPETSKLHLANSMAVRYVNFLGARKQEIICNRGTSGIDGS
NSTAVGCTFTTKEFVTLITGDMAFFYDRNAFWHNYTTNNLRIILLNNHAGGIFRIINGPN
KQPELEEFFETKQSLNAAHLAMDFGFGYLPVKSEEELDAALMDFYHPSVKPKIIEVFSDS
AENTAILNTIKSNLRNFMDQ