Protein Info for Echvi_2328 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 307 (307 residues), 65.3 bits, see alignment E=1.5e-21 PF16363: GDP_Man_Dehyd" amino acids 4 to 334 (331 residues), 172.7 bits, see alignment E=4.5e-54 PF01073: 3Beta_HSD" amino acids 4 to 241 (238 residues), 57.2 bits, see alignment E=4.3e-19 PF02719: Polysacc_synt_2" amino acids 4 to 233 (230 residues), 37.2 bits, see alignment E=6e-13 PF01370: Epimerase" amino acids 4 to 248 (245 residues), 187.2 bits, see alignment E=1e-58 PF07993: NAD_binding_4" amino acids 5 to 183 (179 residues), 26.5 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 59% identical to CAPI_STAAU: Protein CapI (capI) from Staphylococcus aureus

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 66% identity to nsa:Nitsa_1999)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.-

Use Curated BLAST to search for 4.2.1.46 or 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0R1 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Echvi_2328 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFLVTGVAGFIGHGLSKKLLQEGHQVVGIDSINDYYDVNLKLARLKDLGIDDAPISEHQ
KVASTDKSCFEFVKMKLEDGDEMNALFEAERFDIVVNLAAQAGVRYSLENPRAYVDANIV
GFVNLLEACRHHPVKHLVYASSSSVYGANKKMPFSTSDNVDHPVSLYAASKKSNELMAHT
YSHLYGVPTTGLRFFTVYGPWGRPDMALFIFTKAILNGKPLKVFNYGKMKRDFTYVDDIV
EGVYRTALVPPKGQQEGDKEDLSGAPYRLFNIGNSKSVNLMDFIRAIEKATGKEAVLEML
PMQPGDVPATYADVSALSEVTGYKPNTRVEDGVANFVNWYRDYYQV