Protein Info for Echvi_2313 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribonuclease III, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR02191: ribonuclease III" amino acids 30 to 243 (214 residues), 192 bits, see alignment E=5.1e-61 PF14622: Ribonucleas_3_3" amino acids 37 to 164 (128 residues), 99 bits, see alignment E=3.5e-32 PF00636: Ribonuclease_3" amino acids 61 to 149 (89 residues), 76.4 bits, see alignment E=4e-25 PF00035: dsrm" amino acids 179 to 243 (65 residues), 53.2 bits, see alignment E=5.6e-18

Best Hits

Swiss-Prot: 37% identical to RNC_PHYMT: Ribonuclease 3 (rnc) from Phytoplasma mali (strain AT)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 54% identity to mtt:Ftrac_1171)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0P8 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Echvi_2313 ribonuclease III, bacterial (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIFRKLRLHELLYNKKDKRLAAAIKLMVGSKPLNLSLYKLAVRHSSAAEEIKHGVKASN
ERLEFLGDAVLGTVVAEHLFMKFPYRDEGFLTETRSRIVNRESLNRVGQKIGLSNIVESD
LSDKGLYSHKSIYGDTLEALVGAVYLDRGYIFCRQFILSKILSPYFDLDNIITTVTNFKS
KIIEWSQRENKEVEFFLQSVTGTQRFKEFTIELKVEGEVFTEGKGPTKKKAEQEAAKNAF
EKLKLAL