Protein Info for Echvi_2311 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Prolipoprotein diacylglyceryltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details PF01790: LGT" amino acids 23 to 355 (333 residues), 212.9 bits, see alignment E=2.3e-67

Best Hits

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXF1 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Echvi_2311 Prolipoprotein diacylglyceryltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MISTILDYVVWSPNPAVFPGFDRIRWYSLLFALGFIISQQIVIYIFKKEGHDERLVDKLT
IYMVLATIIGARLGHVLFYEPEKYLSNPIEILKVWEGGLASHGAAIAILIALWLYVRNTP
NQRYLWVVDRIVIVVAMTGALIRFGNLMNSEIGGKPTGTDNGFVYAHSTEEILGTLNVPV
EHVAAYKPDDRSGELQGNGQVPVNIDIKIKKGNYQEADLRKTLENDVKYVLTKFNSTEKY
MAEPTDSPLDYDLKDEGDHYLATVRTFGLAKHPTQIYESISYFVIFLILYSLWRKYKARL
PDGLLLGLFLISVFGMRFVWEFFKENQVDFEENLALNMGQTLSIPLVLGGIFLVIRALKI
GNPTQKH