Protein Info for Echvi_2297 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methionyl-tRNA synthetase/methionyl-tRNA synthetase C-terminal region/beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 486 to 505 (20 residues), see Phobius details PF00133: tRNA-synt_1" amino acids 5 to 251 (247 residues), 47.1 bits, see alignment E=3.9e-16 TIGR00398: methionine--tRNA ligase" amino acids 10 to 548 (539 residues), 529 bits, see alignment E=1.4e-162 PF09334: tRNA-synt_1g" amino acids 10 to 404 (395 residues), 520.5 bits, see alignment E=6.2e-160 PF19303: Anticodon_3" amino acids 416 to 558 (143 residues), 68.9 bits, see alignment E=1.2e-22 PF08264: Anticodon_1" amino acids 426 to 542 (117 residues), 31 bits, see alignment E=5.6e-11 TIGR00399: methionine--tRNA ligase, beta subunit" amino acids 561 to 685 (125 residues), 138.7 bits, see alignment E=1.1e-44 PF01588: tRNA_bind" amino acids 591 to 683 (93 residues), 88.3 bits, see alignment E=7.5e-29

Best Hits

Swiss-Prot: 65% identical to SYM_CYTH3: Methionine--tRNA ligase (metG) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01874, methionyl-tRNA synthetase [EC: 6.1.1.10] (inferred from 65% identity to chu:CHU_2689)

Predicted SEED Role

"Methionyl-tRNA synthetase (EC 6.1.1.10)" (EC 6.1.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G146 at UniProt or InterPro

Protein Sequence (686 amino acids)

>Echvi_2297 methionyl-tRNA synthetase/methionyl-tRNA synthetase C-terminal region/beta chain (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKRDFKRYTVTSALPYANGPLHIGHLAGCYIPSDIYVRYLRSLGKDVVYIGGSDEHGVA
ITIKAKKEGVSAQEIVDRYHGIMKASFEEFGISFDHYSRTSSPVHHQTASEFFKDLYDQG
EFLEQTTEQYYDEEAGQFLADRYIEGTCPKCGHEGAYGDQCEKCGSSLSPTELINPKSKL
SGNSPVLKETKHWFLDLGKYAGFLRKWILEEHQQDWKNNVLGQCRSWLETGDGLQARSMT
RDMDWGVPVPVEGAEGKVLYVWFDAPIGYISSTKEWAAEKGVEWEPYWKDEDTKLVHFIG
KDNIVFHCIIFPAILKTHGDYVLPDNVPANEFLNLEGEKISTSRNWAVWLHEYLKEFPGK
QDVLRYVLTANAPEAKDNDFTWKDYQGRNNSELVAIYGNFVNRAVVLTHKYFDGIVPERA
GLSAYDQEVLEGLAAYPDKIAASIEKFRFREALGLVMDFARMGNKYLADTEPWKSIKEDK
DRTGTVLNIALNIAANLGVVSAPFLPFTAQKLADMLGTAGVNWTEAGNSEILKGGETIGK
ATLLFEKVEDSVVEQQVNKLLETKKQNEAANTPVEPVKDTIAFDDFTKMDLRVVTVLEAE
KMKKSKKLLKLVVDTGLGKRTVLSGISEYYKPEDLIGKQVTMLINLAPRKMMGIESEGMI
LMAEDKDGSLRLMMPNGPAAPGSAIN