Protein Info for Echvi_2271 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00072: Response_reg" amino acids 7 to 117 (111 residues), 66 bits, see alignment E=6.8e-22 PF00512: HisKA" amino acids 143 to 204 (62 residues), 38.8 bits, see alignment E=1.6e-13 PF02518: HATPase_c" amino acids 251 to 358 (108 residues), 75.6 bits, see alignment E=8.2e-25 PF14501: HATPase_c_5" amino acids 255 to 346 (92 residues), 29.9 bits, see alignment E=9.5e-11

Best Hits

Predicted SEED Role

"FIG00907945: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXB8 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Echvi_2271 His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSKINVLYLDDEHNNLNSFKASLRRDFKIFTALNAEEGLVIAQQEDVHVVIADQRMPGM
TGVEFFEQLVKFKPEPIRILLTGYSDISSVIDAINKGEVYRFIDKPWNIEQIKNAIKNAA
DIYFIRQELKEKNARLEKMHSEMNQFVYSLSHELRGPLMSISGVSKLAKMECDDRTILEY
FEMIDSATVKLDDFIYKMLDFYRSTKIDNVVTNINFEELLAQQYEAYENKWDLTAVDVET
TINQEERFRSDEAKLRVIFNNLFSNAYKFQQEINPEKYIKIGVDVKDGKAVIQVKDNGIG
IDEKYQSDVFELFQRATQKNVGSGIGLYMVKESVEQLKGTIELDSAVGYGTLFKITIPSL