Protein Info for Echvi_2234 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GH3 auxin-responsive promoter.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 PF03321: GH3" amino acids 16 to 132 (117 residues), 73.2 bits, see alignment E=3.2e-24 amino acids 166 to 272 (107 residues), 27.5 bits, see alignment E=2.7e-10 PF23571: GH3_M" amino acids 303 to 369 (67 residues), 53.3 bits, see alignment E=3.6e-18 PF23572: GH3_C" amino acids 394 to 498 (105 residues), 54.7 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 61% identity to mtt:Ftrac_1198)

Predicted SEED Role

"putative auxin-regulated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX65 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Echvi_2234 GH3 auxin-responsive promoter. (Echinicola vietnamensis KMM 6221, DSM 17526)
MAILGTLLKRGIRLRESLEQEYSSPLELQKQELKKLLITASKTQMAEKYGFRTILSEFPK
EGDAFYKSFSSHVPIYDYDKIYEEWWHKLQEGEKNVTWPKAIKYFALSSGTSGSASKYIP
ISKEMVKAIRKTGVRQILTLSKYDLPSKLFNKGILMLGGSTDLEFNGTYFAGDLSGITAG
KLPIWFQRFYKPGQEIARNKNWADKLEKIVENAPKWDIGIIVGVPAWLQILIEKIIERYE
VDTIHDIWPNLTIFVHGGVSFEPYKKGFEKLLAKPLIYLETYLASEGFLAFQALPNRSSM
RLVLNNGIFYEFVPFNGLYFDENSELRDDVKPLKIDEVEEGVDYALLISTCAGAWRYMIG
DVIRFVSVKDSEIIITGRTKHFLSLCGEHLSVDNMNKAVKMAEDELNIHVREFTVLGVPH
GTLFGHHWYIGTDDEVDSERLCAVIDDNLKVLNDDYVTERKHALREVRLDVLPSSVFYDW
MREQGKEGGQHKFPRVLKGPRMEAWLEFLEKQ