Protein Info for Echvi_2228 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00702: Hydrolase" amino acids 7 to 183 (177 residues), 99 bits, see alignment E=7e-32 PF13419: HAD_2" amino acids 9 to 188 (180 residues), 103.6 bits, see alignment E=1.9e-33 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 66 to 189 (124 residues), 66.3 bits, see alignment E=3.5e-22 PF13242: Hydrolase_like" amino acids 145 to 192 (48 residues), 26.4 bits, see alignment 8.1e-10

Best Hits

KEGG orthology group: None (inferred from 67% identity to psn:Pedsa_3651)

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.6

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZL4 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Echvi_2228 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNKDLTFIFDMNGTMIDDMHFHTKAWHQLFNEDLGANLSWEEVKVEMYGKNPEVLDRVF
GKGHFTPQEAEEWSMKKEKRYQEEYRPHLALIKGLDEFLEKANDAGIKMAVGTAAIPFNV
DFALDNLDIRKYFSAIVTADDVKLSKPHPDTFTMAAEKLKREPEDCIVFEDAPKGVEAAQ
NAGMKAVVITTAHPKEDFQQYDNVLAFIEDYDDPFIKELI