Protein Info for Echvi_2216 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pantetheine-phosphate adenylyltransferase, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR01510: pantetheine-phosphate adenylyltransferase" amino acids 4 to 151 (148 residues), 169.5 bits, see alignment E=5.5e-54 TIGR00125: cytidyltransferase-like domain" amino acids 5 to 47 (43 residues), 40.8 bits, see alignment E=2e-14 PF01467: CTP_transf_like" amino acids 6 to 135 (130 residues), 76.2 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 58% identical to COAD_CYTH3: Phosphopantetheine adenylyltransferase (coaD) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 69% identity to mtt:Ftrac_0894)

MetaCyc: 40% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0D0 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Echvi_2216 pantetheine-phosphate adenylyltransferase, bacterial (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKTAIFPGSFDPYTNGHHDIVMRGLDIFDEIVVGIGYNSSKKSRYFEIDKMVQKIEEVY
KDIPAVKVVVYNELTSSLAKKHNANFLLRGLRNTTDFEYENTISQMNRYLNTDLETVFLI
TSPQYAAVSSTIIREVHRYGGNVSEFLPYEV