Protein Info for Echvi_2207 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 1-acyl-sn-glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00655, 1-acyl-sn-glycerol-3-phosphate acyltransferase [EC: 2.3.1.51] (inferred from 43% identity to chu:CHU_2828)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

CDP-diacylglycerol biosynthesis I (4/4 steps found)
CDP-diacylglycerol biosynthesis II (4/4 steps found)
oleate biosynthesis III (cyanobacteria) (2/3 steps found)
phosphatidylglycerol biosynthesis I (4/6 steps found)
phosphatidylglycerol biosynthesis II (4/6 steps found)
palmitoleate biosynthesis III (cyanobacteria) (1/2 steps found)
phospholipid remodeling (phosphatidate, yeast) (1/2 steps found)
CDP-diacylglycerol biosynthesis III (3/5 steps found)
phosphatidate biosynthesis (yeast) (3/5 steps found)
superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
palmitoyl ethanolamide biosynthesis (2/6 steps found)
superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
stigma estolide biosynthesis (2/7 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (6/13 steps found)
anandamide biosynthesis II (2/8 steps found)
anandamide biosynthesis I (3/12 steps found)
plasmalogen biosynthesis I (aerobic) (2/16 steps found)
superpathway of phospholipid biosynthesis II (plants) (8/28 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYT3 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Echvi_2207 1-acyl-sn-glycerol-3-phosphate acyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRLLRRIYSTYGTIIFLGSFLVLLPLFIITIEVPGLKKYGRKLNGIWAKVFFTGLFMRVI
VENKHHLKQYPQYIIVANHFSYLDIPVIGLMSGDAVFVGKSSIGKVPLFGYMFKKLHIAV
DRASFRSRGETLKRTKEIIDEGSSIIIFPEGGIRSTEPPIIAPFKDGAFNLAFEKQIPII
PVTLSYNHLILPDDNKFLLHYKPVKVVIHAPMMPEGSGKDAVANMKLRCHKVIQDQLWKD
N