Protein Info for Echvi_2194 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ADP-ribose pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF00293: NUDIX" amino acids 46 to 153 (108 residues), 43.1 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 61% identity to sli:Slin_1662)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX16 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Echvi_2194 ADP-ribose pyrophosphatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEENPWKTKTRKLMYSNPWIALEEHEVVTPAGTDGVYGKVSFKNKAMAILPVDEELNTWL
VGQFRYAIDEYSWEIPEGGSPIGEDILEGAKRELKEETGLAADKWTPIMRFHTSNSVTDE
EGFAYLAEGLTEGETAFEDTEKIEVKKLPLKAVVQMVMDGEITDVISVAVILKAARMLGI