Protein Info for Echvi_2188 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methyltransferase domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13489: Methyltransf_23" amino acids 26 to 146 (121 residues), 65.1 bits, see alignment E=2e-21 PF13847: Methyltransf_31" amino acids 38 to 145 (108 residues), 53 bits, see alignment E=9.7e-18 PF07021: MetW" amino acids 38 to 141 (104 residues), 30.3 bits, see alignment E=9.4e-11 PF13649: Methyltransf_25" amino acids 39 to 127 (89 residues), 54.9 bits, see alignment E=3.6e-18 PF08241: Methyltransf_11" amino acids 39 to 131 (93 residues), 65 bits, see alignment E=2.5e-21 PF08242: Methyltransf_12" amino acids 39 to 128 (90 residues), 53 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 58% identity to mtt:Ftrac_2286)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX09 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Echvi_2188 Methyltransferase domain. (Echinicola vietnamensis KMM 6221, DSM 17526)
MATYTTEIASDKLVSDNPIHQRLLKAYIAAKPLVSGDLLEIGCGEGRGVEVLSEHVTTYH
GLDKIGEVINTLQQRFPKATFEQATIPPLETVPSDHYDTVVSFQVIEHIQEDKLFLEEIY
RVLKPGGKAIISTPNIRHTLSRNPWHIREYTGTELIRLCEQVFDKVVAKGIGGNDKVWNY
HEANRKSVNKIMRFDIFDLQHRLPASILRMPYELLNRMNRNKLHKQGGDAVTDITHDDYL
VVDHPDKGLDLFYVLEKE