Protein Info for Echvi_2136 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GTP cyclohydrolase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 51 to 229 (179 residues), 224.8 bits, E=2.8e-71
• TIGR00063: GTP cyclohydrolase I
  • amino acids 51 to 229 (179 residues), 247.1 bits, E=4.1e-78

Best Hits

Swiss-Prot: 61% identical to GCH1_FLAJ1: GTP cyclohydrolase 1 (folE) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 74% identity to mtt:Ftrac_0670)

MetaCyc: 58% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (10/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (5/5 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (1/4 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

See L0FYL1 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Echvi_2136 GTP cyclohydrolase I (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQKGIMLNTTGIDIDRSIDEIGDEHIGTSHETPLREDAFEMDDELKMELIEKHFKDIMH
VLGLDLTDDSLKGTPRRVAKMFVQEVFSGLDPKNKPEIKLFENKYKYSEMLVEKDITFFS
HCEHHFVPIYGKAHVAYISNGNVIGLSKINRIVQYFAKRPQVQERLTMQIGNELKEILGT
DDVAVVIDAHHMCVSSRGVKDVNSKTVTSFYSGKFDKDDSTRKEFMQYVTMQ