Protein Info for Echvi_2135 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 6-pyruvoyl-tetrahydropterin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01242: PTPS
  • amino acids 5 to 135 (131 residues), 120 bits, E=3e-39

Best Hits

Swiss-Prot: 44% identical to PTPS_HUMAN: 6-pyruvoyl tetrahydrobiopterin synthase (PTS) from Homo sapiens

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 72% identity to mtt:Ftrac_0669)

MetaCyc: 44% identical to 6-pyruvoyl tetrahydrobiopterin synthase monomer (Homo sapiens)

Predicted SEED Role

"6-pyruvoyl tetrahydrobiopterin synthase (EC 4.2.3.12)" in subsystem Folate Biosynthesis or Pterin biosynthesis (EC 4.2.3.12)

MetaCyc Pathways

• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.12

Use Curated BLAST to search for 4.2.3.12

Sequence Analysis Tools

See L0G044 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Echvi_2135 6-pyruvoyl-tetrahydropterin synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRVAVYRKEHFNAAHRLFNPEWSDEKNSQVFGKCNNPSYHGHNYDLHVKLVGPIDPATGY
VYDMKVLSDMIREKVINKFDHKNLNLDTDEFKQLNPTAENIAVVIWNILRKEIEEKYDLT
VRLYETERNYVEYDGH