Protein Info for Echvi_2129 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 PF00583: Acetyltransf_1" amino acids 25 to 142 (118 residues), 31.6 bits, see alignment E=1.8e-11 PF00795: CN_hydrolase" amino acids 230 to 490 (261 residues), 122.7 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 46% identical to YHCX_BACSU: Hydrolase YhcX (yhcX) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 65% identity to chu:CHU_2523)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0I2 at UniProt or InterPro

Protein Sequence (513 amino acids)

>Echvi_2129 Predicted amidohydrolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKHKEELEHRLKLRNIQLSDYNDIRELMTLIYEQKGMAYTRQELKNQIKAFPEGQICIE
DNGKVVAVALSVVVEYSKFGDSHTYDEITGFGKFDTHDLENGDTLYGTDVFVHPEYRGLR
LGRRLYDARKELCENLNLRSIIAGGRIPGYSKYADQMTPRKYIELVKNKEIYDPVLSFQL
ANEFHVRKVITKYLPEDKDSKAFATLLEWNNIYYEKDEKLIGNSKSIVRLGLVQWKMRRF
KDVDDLMQQVEFFVDTVSGYKSDFCLLPEFFNAPLLADFNDMDASEAIRNLADYTEEVLS
RMRDLALSYNVNIIAGSMPEYDGKKLRNVSYLCRRDGTTDKQYKLHITPDEQAYWGLQGG
NGISVFDTDAGRIGILICYDVEFPELGRILAEQEMDILFVPFWTDTKNAYLRVSTCAKAR
AVENECYVAITGSVGNLPRVENMDIQHSQAAIYSPSDFSFPHDAVIAEASLNTETTIVAD
VDLDLLTKLRKMGSVRNLAQRRLDVYSIQWKRK