Protein Info for Echvi_2107 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF00510: COX3" amino acids 189 to 254 (66 residues), 37.7 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 68% identity to mtt:Ftrac_3697)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1); Cytochrome c oxidase, subunit III (EC 1.9.3.1)" (EC 1.9.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ75 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Echvi_2107 Heme/copper-type cytochrome/quinol oxidase, subunit 3 (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSTAIEINSKRGIWGGGNEPLKASYGKLMMWFFLLSDIFTFAAFLITYGSIRVSYPAFE
GHVSEFVKSNEHWPIPEMIFNAFPFFHGVHLPLVFVGLMTFILIMSSVTMVLAVEAGHRN
DKKDVVKWMLWTMLGGITFLSCQAWEWSHFIHGSDEGTMMTFVNTFGETVKEVVYGANLH
VNEYGPAPFAQLFFFITGFHGFHVTIGVVLLFLAFYQAAVGVYERRGHYEMVEKIGLYWH
FVDLVWVFVFTFYYLV