Protein Info for Echvi_2106 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Heme/copper-type cytochrome/quinol oxidase, subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 66 to 189 (124 residues), 52 bits, E=4.9e-18

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 63% identity to mtt:Ftrac_3696)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See L0FYI2 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Echvi_2106 Heme/copper-type cytochrome/quinol oxidase, subunit 3 (Echinicola vietnamensis KMM 6221, DSM 17526)
MEERLAYTEGAEQPIAMHPKKFALWLFIVSVVMIFAAMTSAFIVRQGEGNWLDYDLPSIL
WYTSGIILLSSASMHWAYLSAKNDRINHLKIALTITTALGLVFLVGQWFSWVALVERDVY
FVGNPAGSFMYVLTGLHAAHLISGVIFLIIVLISSFRYQIHSKEMNTLEMCATYWHFLGG
LWIYLFVFLLLNH