Protein Info for Echvi_2104 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein required for cytochrome oxidase assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 14 to 83 (70 residues), 53.7 bits, see alignment E=8.4e-19 amino acids 102 to 339 (238 residues), 118.1 bits, see alignment E=2.2e-38

Best Hits

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0F4 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Echvi_2104 Uncharacterized protein required for cytochrome oxidase assembly (Echinicola vietnamensis KMM 6221, DSM 17526)
MNQKNHKNIRSFRRISLVTAIAVYFLILVGGIVRSTGAGMGCPDWPKCFGSWIPPTAVEQ
LPDNYQEIYLNKRLEKNERFVKMLHGLGFHQKAEEIKHSKAILVEEEFNATKTWIEYLNR
LTGAIIGLLVIATFVYAFRLRKEDRMLAILSFANLLLVIFQGWIGSIVVSTNLLHWMITV
HMVLALLIVCLLLYVHYRAFKLNHTIQPKTERPNYLYGVLVVGFLLMIIQVVWGTQVREE
IDLIALQFGSLFRSEWISHLGVNFMIHRSFSLVLLFLHLWFVYKVYMFSYRSSSIFKWSQ
VLLVLIFIEIITGASMAYFGIPAFLQPVHLLVGSLIIGVQFVILLQLSDQKSIVLNTSNS