Protein Info for Echvi_2096 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cytochrome c, mono- and diheme variants

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 162 to 187 (26 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 43 to 130 (88 residues), 30.1 bits, see alignment E=1.2e-10 PF00034: Cytochrom_C" amino acids 45 to 131 (87 residues), 46 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: None (inferred from 57% identity to mtt:Ftrac_3686)

Predicted SEED Role

"Molybdopterin oxidoreductase subunit, predicted; chaperone protein HtpG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYH2 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Echvi_2096 Cytochrome c, mono- and diheme variants (Echinicola vietnamensis KMM 6221, DSM 17526)
MSIKRSLLSVPFRFCNMALIFSFLLLGINAFAADPEVSDSEDAIKAGESLFNANCKTCHK
LDQKFTGPALRGVSDRRDIAWIQAFIKNSQKVIQSGDADATALFAEFNNTVMPAHPFLSD
EDVMNLLSYIEYGGQEEAAPAEGGAEGAASGATSSGVPSEYLTIILAVLVVVLLLILIVL
GLIVSVLTKYLNKQPLEEEDKEFINQKTDFKKVLKSDAFIIIVTAIVVALVAKTAIDGLY
TVGVQQGYQPTQPIAFSHKLHAGDKEIPCQYCHTGVEIGRSANIPSPNICMNCHMHVQNV
AGKEGVSPEIQKIYDAVDNNQPIEWVRVHNLPDLAYFNHSQHVKVGGIECQTCHGPIEEM
EVVRQHSALTMGWCIDCHRKTDIKTAGNEYYDKLVQLHSESKDALKVKDIGGLECAKCHY