Protein Info for Echvi_2091 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted amino acid aldolase or racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF01168: Ala_racemase_N" amino acids 22 to 239 (218 residues), 68.3 bits, see alignment E=8e-23 PF14031: D-ser_dehydrat" amino acids 259 to 348 (90 residues), 67 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: None (inferred from 50% identity to sli:Slin_1233)

Predicted SEED Role

"low-specificity D-threonine aldolase" in subsystem Serine-glyoxylate cycle or Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ61 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Echvi_2091 Predicted amino acid aldolase or racemase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDWYEIKEVEAIDSPALAVYPKRVKSNIGKLKSMVKEVSRLQPHIKTVKCMEVVKMLMDA
GIDKFKCATIAEAEMLGMAGAKEVLIAYPMVGPKVDRMIKLMLVYQDTEFSCLVDCPEQA
RHLSAHTYQADVYLRVFLDLNVGTDRTGVRPLEEAMDLYDYCKETSHLITMGLHIYDGHI
RHKDLALRKEACDTAFAPVEALAEQLKKKYDGGLKVIAGGSPTFPIHAQRPGVTCSPGTF
AYWDKGYQEGLSEQSFEFAAVLMGRVISRPGEKLICLDLGYKSVASEGALDRRVWFPDHP
IWNPVGHSEEHLVVEVPKDDRPPVGEVVYAIPYHICPTVAMYDRVLTVDNHKLSGEWKTL
ARKRRINI