Protein Info for Echvi_2085 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: putative glycoprotease GCP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 6 to 317 (312 residues), 415.3 bits, see alignment E=1.5e-128 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 7 to 310 (304 residues), 354.9 bits, see alignment E=3.6e-110 PF00814: TsaD" amino acids 25 to 310 (286 residues), 334.9 bits, see alignment E=4.4e-104 PF22521: HypF_C_2" amino acids 233 to 300 (68 residues), 30.1 bits, see alignment E=4.1e-11

Best Hits

Swiss-Prot: 65% identical to TSAD_CYTH3: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 70% identity to dfe:Dfer_3012)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYG0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Echvi_2085 putative glycoprotease GCP (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNINILAIESSCDETSASIISNGKILNNIVATQSVHEKYGGVVPELASRAHQQHLIPVI
HEAITEAGIAHEELSAVAFTRGPGLMGSLMVGVSFAKSFAYALDIPLIDVNHMQAHILAH
FIDDPKPAFPFICLTVSGGHTQLVLVKDYLEMEVIGETLDDAVGEAFDKTAKLLGLPYPG
GPLVDKYAKEGNPQAFQFPLSEMPGLNYSFSGIKTAVLYFLRDRLKEDADFITENMADIC
ASVQFTLIKMLMQKLKRAAREHKVKEIAIAGGVSANSGLRAELNRLAGELGWNVYVPKFE
YCTDNAAMIAMAAHYKYLKGAFCGLDVSPVAKMKL