Protein Info for Echvi_2080 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cystathionine beta-lyases/cystathionine gamma-synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to METC_COXBU: Cystathionine beta-lyase (metC) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 72% identity to mtt:Ftrac_3758)

MetaCyc: 52% identical to cystathionine gamma-lyase (Helicobacter pylori 26695)
Cystathionine gamma-lyase. [EC: 4.4.1.1]

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
D-serine degradation (3/3 steps found)
L-cysteine degradation II (3/3 steps found)
L-methionine degradation II (3/3 steps found)
L-serine degradation (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
homocysteine and cysteine interconversion (3/4 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
glycine betaine degradation III (4/7 steps found)
L-threonine degradation I (3/6 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
superpathway of L-threonine metabolism (11/18 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
superpathway of L-methionine salvage and degradation (9/16 steps found)
glutathione-mediated detoxification I (3/8 steps found)
hypoglycin biosynthesis (4/14 steps found)
purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYF5 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Echvi_2080 Cystathionine beta-lyases/cystathionine gamma-synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFGTKVIHAGVAPDPTTGAIMTPIFQTSTYVQKSPGQHKGFEYSRTHNPTRDALQKSIA
ALENGKHGLCFSSGMGAIDALIKLLSPGDEVISTNDLYGGTYRIFTKVFAKYGIKFHFVS
MDDPASIEKYINDKTRLIWAETPTNPMMNIIDIKALAAIAGKHDLLLGVDNTFATPYLQN
PLDLGADLVMHSVTKYLAGHSDVVMGALVVNDDRLAEDLAFIQNSCGATPGPQDCFLVLR
GIKTLHLRMERHCQNGKTIAGYLRHHPKVDKVYWPGFEDHPNHDIAAKQMRDFGGMISFS
IVGDKQEDAKKVLENLHYFSLAESLGGVESLCGHPASMTHASIPKVEREKVGLTDSLIRL
SVGVEDAEDLKNDLAAALELI