Protein Info for Echvi_2078 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 180 to 204 (25 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 464 to 479 (16 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 350 to 415 (66 residues), 81.2 bits, see alignment E=4.9e-27 PF21082: MS_channel_3rd" amino acids 424 to 509 (86 residues), 37.4 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_3759)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0C8 at UniProt or InterPro

Protein Sequence (553 amino acids)

>Echvi_2078 Small-conductance mechanosensitive channel (Echinicola vietnamensis KMM 6221, DSM 17526)
MVVRFRFLLLGWLLLVSNVLYGVDGEFDKDFPQIQDTASYVNLSTPYTTTLTFFLNLEER
NFKPENAAKTLGGDLTPEQARKQVVKLKQIFDGQGVFVDVDNVPNEANYTDSTRSYQAKY
FYDNNRLPKIFLEKTGDKWKFSSYTVSQINELHKETYPYGTAKLLNLLPKIGQQVYLGLH
LWQLCGIFLLVLFVFTAHKLFTFIVDRGMFHVSLKLGYKQVAETYLLPVARVISIYFVVL
LVDIFIRVLQLPIEVVSWIVILLNAAKPLIITIVFYKLADLLSAYFERQADKTESNLDDQ
LVPLVRKTLKAFIIIVGSLFILKNGLQVDIWPFLTGLSIGGLAFALAAQDTIKNFFGSVM
IFIDKPFQVGDWITSGDVDGTVEEVGFRSTRVRTFRNSLMYIPNGRIADATIDNHGLRQY
RRFSTTITITYGTPPELINVFVEGLREIVKNHPLTRKDFYNVYFNNMSAYSLDIMFYVFF
EVPTWGDELKGRHEILIQIVKLANELGVNFAFPTQTLHMETFPEKEGLSPIYEDNADAYK
QRLDAFIKKEMKK