Protein Info for Echvi_2076 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: malate dehydrogenase, NAD-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 TIGR01763: malate dehydrogenase, NAD-dependent" amino acids 2 to 306 (305 residues), 432.4 bits, see alignment E=4.4e-134 PF00056: Ldh_1_N" amino acids 2 to 143 (142 residues), 144.4 bits, see alignment E=2.5e-46 PF02866: Ldh_1_C" amino acids 148 to 303 (156 residues), 121.7 bits, see alignment E=3.4e-39

Best Hits

Swiss-Prot: 81% identical to MDH_CYTH3: Malate dehydrogenase (mdh) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 81% identity to chu:CHU_3020)

MetaCyc: 47% identical to malate dehydrogenase subunit (Methylorubrum extorquens AM1)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ45 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Echvi_2076 malate dehydrogenase, NAD-dependent (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKVTVVGAGNVGATCADVLAYREIAEEIVLVDIKEGVAEGKALDIWQKAPINAYDSRTV
GSTNDYTKTAGSDVVVITSGLPRKPGMTRDDLIETNAGIVKSVTENVVKHSPDAIIIIVS
NPLDVMTYQAHITSKMPRTKVMGMAGILDTARYRAFLAEALDVSPKEIQAILMGGHGDTM
VPLPRYTTVAGIPVTELIEKDKLDAIIERTKFGGGELVKLMGTSAWYAPGSAAAQMVEAI
LKNQRRVFPVCVKLDGEYGIDDCYLGVPVILGKNGIEKVIELDLNEDEKALLETSRKHVK
EVMAVLDSVGSK