Protein Info for Echvi_2048 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases, probably involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 23 to 376 (354 residues), 61.4 bits, see alignment E=1e-20 PF13641: Glyco_tranf_2_3" amino acids 47 to 275 (229 residues), 59 bits, see alignment E=9e-20 PF00535: Glycos_transf_2" amino acids 48 to 215 (168 residues), 66.1 bits, see alignment E=5.8e-22

Best Hits

KEGG orthology group: None (inferred from 46% identity to fps:FP1465)

Predicted SEED Role

"N-acetylglucosaminyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0A0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Echvi_2048 Glycosyltransferases, probably involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MIIDLLWLIFGAATFIQVIYFLFVYGKLSYFYQDKSESTADHNQEGVTVVIAAHNEAENL
QKLIPLLFQQNYPAFEVLIINDRSYDDTRFLLEQMMKEYPMLRTVTIEYTPEHVTAKKYA
LTLGIKVAKYDVLLLTDADCLPVSENWIKRMTHPIRNGKKTFSLGYGGYGKGKGFLNALI
QFETWFTAIQYFSFALWKAPFMGVGRNLAYRRTYFMDHKAFKDLWHILGGDDDLYVNRHA
KKHNTAVVIHPEGITESIPKKTFKEYYVQKTRHYQAGKYYKTSDKAKIGLYAISHLFFWA
TAIALISITQKWEPIAVIVSIIVTRALLQFSIFNNAIKKIEGQKKVLWTMFFDLMYLSYF
WIIGAKGYLSKTVRWK