Protein Info for Echvi_2033 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: HflK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details amino acids 39 to 40 (2 residues), see Phobius details transmembrane" amino acids 23 to 38 (16 residues), see Phobius details TIGR01933: HflK protein" amino acids 36 to 317 (282 residues), 291.6 bits, see alignment E=2.7e-91 PF01145: Band_7" amino acids 38 to 231 (194 residues), 103.9 bits, see alignment E=5.2e-34

Best Hits

Swiss-Prot: 42% identical to HFLK_TREPA: Protein HflK (hflK) from Treponema pallidum (strain Nichols)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 62% identity to mtt:Ftrac_0676)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G082 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Echvi_2033 HflK protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSNRNFNINIDPDMIKRNLRKIILGLVIIVAAFSAIHTVGPEEEGVVIQMGKYNRTVPPG
LNFTLPFGIEKMHKIPVQRQLKQEFGFRTTSPNQRSEYVKEGYLGESTMLTGDLNLTDVE
WVVQYRINDSYKYLFKVRNADKTLRDMSEAAMRKIVGDRTVNEVLTVGRQEIASSVEQLL
QELCDEYENGIRIDQVVLQDVNPPDPVKPSFNAVNEAQQERETLINQAEADYNRVIPRAR
GEALETIELAEAYALNRVNRAKGEAERFNSLFEAYRKAPEVTKQRIYLETMEKVLPKLDN
KVIVDEEGNNVLPLLNLNKQGGTEK