Protein Info for Echvi_2015 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details TIGR01939: NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit" amino acids 21 to 221 (201 residues), 260.7 bits, see alignment E=5.2e-82 PF02508: Rnf-Nqr" amino acids 25 to 215 (191 residues), 190.3 bits, see alignment E=1.5e-60

Best Hits

Swiss-Prot: 55% identical to NQRD_PASMU: Na(+)-translocating NADH-quinone reductase subunit D (nqrD) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K00349, Na+-transporting NADH:ubiquinone oxidoreductase subunit D [EC: 1.6.5.-] (inferred from 74% identity to mtt:Ftrac_1551)

MetaCyc: 52% identical to Na(+)-translocating NADH-quinone reductase subunit D (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit D (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYZ2 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Echvi_2015 NADH:ubiquinone oxidoreductase, Na(+)-translocating, D subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MSTETAEKTEIKKPAEALLSKRRKKLISDPLVDDNPITIQVLGICSALAVTTQMKPTLVM
ALSVIFVIVMSNLTISIMRNTIPTRVRIIVQLAVVATLVTLVNEILKAFAYDMYKELSVF
VGLIITNCIVMGRLEAFALGNKPYDSVLDGFGSALGYSWIILTVAFFRELWGSGSVFGIP
VFDTVSSWFGEDFSLATNGLMVSPVGAFIILGLIIWVQRTKTGYVEH