Protein Info for Echvi_2009 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: adenine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 506 to 524 (19 residues), see Phobius details TIGR01178: adenine deaminase" amino acids 7 to 538 (532 residues), 609.5 bits, see alignment E=2.6e-187 PF01979: Amidohydro_1" amino acids 43 to 323 (281 residues), 139.8 bits, see alignment E=1.4e-44 PF13382: Adenine_deam_C" amino acids 370 to 536 (167 residues), 188.9 bits, see alignment E=5.3e-60

Best Hits

Swiss-Prot: 59% identical to ADEC_FLAPJ: Adenine deaminase (ade) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K01486, adenine deaminase [EC: 3.5.4.2] (inferred from 62% identity to cpi:Cpin_1198)

Predicted SEED Role

"Adenine deaminase (EC 3.5.4.2)" in subsystem Purine conversions (EC 3.5.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY83 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Echvi_2009 adenine deaminase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSAFHIAGQLVNIPDQKISPVKMTIENGKITSVEPTESAPELYLMPGFIDAHVHVESSML
IPSEFARLAVVHGTVATVSDPHEIANVCGKKGVEYMIENGKRVNFNFYFGAPSCVPATPF
ETAGGEITAQDIDELLDRKEVRYLAEMMNWPGVINRDPAVMDKIALAAKHGKPVDGHAPG
LKGLDAQNYISAGISTDHECFTEEEALAKLQHGMKIIVREGSAAKNFEALIDLIDDHAEH
MMFCSDDKHPDNLVIGHINQLAARAVAKGKGLFKVLQAACLNPIAHYGMDVGQLRPGDPA
DFIICKDLKDFQVTATYIKGQKVAENGRSLLPSVASSPINNFSTSAKHPDDFKLPAPTSR
AKVIEAFDGQLITRECIEDIQVLEGYAEANVAKDVLKFAVVNRYQDTVPSIAFIKNVGLK
EGAIASSVGHDSHNILAVGVDNASITKAVNMIIKEKGGISAVSASKELILPLPIAGIMSA
MDGYEVAKLYTQIDLLAKKMGSKLDAPYMTLSFMALLVIPALKLSDKGLFDGTSFQFTSP
FHREN