Protein Info for Echvi_2008 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 311 to 420 (110 residues), 94.8 bits, see alignment E=2.2e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZS2 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Echvi_2008 Signal transduction histidine kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
METDQEMETKIFNSAALIIVIYLKAMIIFNLILGQYFLALILLVTSAVILAFYLIGRSKQ
SFNRGITFLSLLGYPIIAIVFFYNDGIAGPAFYIFLMIHTTILAVTQIKTYWFWGLYNLV
FFLGLFYMGIYHADLISITYTSSEVQYLDHSITYTACLAGIVAIIIALKWNYQKQKQQSE
RNGEALRDAIQELSQTNEQKNKIIALISHDLKNPLLSITKILEMINDGELEKEETEAILK
ELYIIANNAQKMSEEILEWATLELKNTSPKFRHVDLKEYCDSMLTIYKGMARQKNITLET
SFEGDTFLTTDIDRLLLIVRNLLQNAIKFTAEKGEIIFSCRNTEKNFHISITDTGNGIPK
ERLQRLFNMKFESTSGTSLEKGTGVGLYISNENAKKIGGSLKVDSKVGKGSVFTLTLPKK
PSIATPSQ