Protein Info for Echvi_2001 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): homoserine kinase (EC 2.7.1.39)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00191.
Original annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 7 to 308 (302 residues), 231.7 bits, E=4.5e-73
• PF00288: GHMP_kinases_N
  • amino acids 67 to 149 (83 residues), 68.6 bits, E=4.4e-23
• PF08544: GHMP_kinases_C
  • amino acids 210 to 287 (78 residues), 46.6 bits, E=3.8e-16

Best Hits

Swiss-Prot: 50% identical to KHSE_CHLPB: Homoserine kinase (thrB) from Chlorobium phaeobacteroides (strain BS1)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 55% identity to chu:CHU_0074)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• aspartate superpathway (20/25 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

See L0FWH2 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Echvi_2001 homoserine kinase (EC 2.7.1.39) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVTAFAPATVANVSCGFDILGFAVEEMGDKVTVSLADEPGVRVVRIEGDGGRLPYEVD
KNTCGVALKAFLAAIDYKGGLEVELYKGLPLGSGMGSSAASSVAALEAANQLLGNPLDKK
ALLPFAMKAEGVACGAEHADNVAPSLLGGFVLIRSYHPLDVTKLHVPKGLYCALVHPHLE
LNTADSRSVLRQQVPLKDAITQSGNIAGLVAGLYQEDMGLISRSLQDVIAEPSRSVLIPG
FDEIKSAIKEVGALGVGISGSGPTTFILAPSREVAERASEICQEVFDKIGLEVDLYVSAV
NTKGTYVINKA