Protein Info for Echvi_1920 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 transmembrane" amino acids 28 to 56 (29 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 125 (33 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 235 to 250 (16 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 444 to 460 (17 residues), see Phobius details amino acids 466 to 482 (17 residues), see Phobius details amino acids 487 to 505 (19 residues), see Phobius details amino acids 517 to 536 (20 residues), see Phobius details PF12805: FUSC-like" amino acids 71 to 342 (272 residues), 163.4 bits, see alignment E=1.2e-51 PF04632: FUSC" amino acids 393 to 593 (201 residues), 33.6 bits, see alignment E=3.6e-12 PF11744: ALMT" amino acids 395 to 582 (188 residues), 27.7 bits, see alignment E=2.6e-10 PF13515: FUSC_2" amino acids 403 to 529 (127 residues), 75.2 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 43% identity to shg:Sph21_3164)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZX2 at UniProt or InterPro

Protein Sequence (714 amino acids)

>Echvi_1920 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSFFNPTAIKSFILGQYFTDGVKMTLGVLLPAVIFSFLGDFRTGISISLGAFLVSISDST
GPLEHRRTGMLASCGFVFLSALVTGVLNQSPVLLAIEIPVFCFVFAMFTVYGTRAASVGA
GALLGMAISMDPHKTAAAFWLYALMVLAGGIWYTLLSLSIMQIRPYRVAQQALGESVLQV
AAFLRQKAAFYSSETDVETNYRKLAAVQVAVNEHQDSVREMLYKTRKRVGESISSGQLLL
VIFVDMVDIFEQMMASHYDYKKLRELYGQYPVMHDFKRGIQLVAEELSRLGYALINNEKP
RHPHYPEDFLAGLREQIEALEQTGVKCLMLRKIYANLASITARVDDIYNYFYEDKLTFIS
QTREASLSKFIGHQSFSLKLIRDNLTLESNVFRHALRLAVTCLVGYLISLQVSLGSHSYW
VVLTILVILRPGFSLTKRRNTQRILGTLLGGFTGVLILYLVPDFSLRFVFLVIFMVLAYS
FLRIRYFLAVVFMTPFIFIVYAFLYPESNFLIVRERIIDTVLGSGLAYLASNFFLPSWEY
TGFRQMAASVLQANLEYFAQIISRFDAKAFDEVAYRLARKKMYLRSASLSAAFQRMLDEP
KSKQRNKQDLHQFVVLNHILSSYFSTLSSSLVRADVVLSSHGQVVKIKRIRNYLLRSLEH
LGEKGESLDFSVLDHEDGLLKITDSAETSLLTEQLQLIQKTCSDLEKLSRKVAS