Protein Info for Echvi_1893 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: molybdenum cofactor biosynthesis protein MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 6 to 154 (149 residues), 184.6 bits, see alignment E=4.4e-59 PF01967: MoaC" amino acids 17 to 152 (136 residues), 172.6 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 55% identical to MOAC_XANC5: Cyclic pyranopterin monophosphate synthase (moaC) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 64% identity to zpr:ZPR_2979)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYN2 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Echvi_1893 molybdenum cofactor biosynthesis protein MoaC (Echinicola vietnamensis KMM 6221, DSM 17526)
MKDQKLSHVDSDGNAKMVDVSEKSVTKRTATAQSVVTFPKAVFDQLSKDNFLGKKGSIIQ
TAIIAGTMAAKKTSDLIPLCHPLALSKIQLDIAPGDHQLNITATVKCEGKTGVEMEALTA
ASVAALTIYDMCKALTHDINITETKLMAKEGGKNAFNR