Protein Info for Echvi_1889 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF01225: Mur_ligase" amino acids 15 to 87 (73 residues), 30.4 bits, see alignment E=6.2e-11 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 19 to 430 (412 residues), 366.1 bits, see alignment E=1.3e-113 PF08245: Mur_ligase_M" amino acids 98 to 278 (181 residues), 120.8 bits, see alignment E=1.1e-38 PF02875: Mur_ligase_C" amino acids 301 to 379 (79 residues), 41.3 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 58% identity to chu:CHU_0699)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.10

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW71 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Echvi_1889 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTSIESLYTVYKQSTGVSTDTRKIEKGNLFFALKGPNFNANSFAAKALDMGASAVVIDEE
EFAVAGDARYVLVDDVLVALQQLANHHRKQLDIPFLAITGSNGKTTTKELINAVLAKKYK
TYATVGNLNNHIGVPLTLLAMDETTEIGIVEMGANKIGDIAALCEIAEPTHGLITNIGRA
HLEGFGGFEGVLRAKTELYQFLISHKGKIFVNSQNQVLANMIKRMDDPITYPSKGDFYHC
ELVAANPFVTFKLAKGSIHETKMLGGYNFENIATALTVGVFFGVEENIAATAICAYTPGN
MRSQLIEKRSNLIVLDAYNANPSSMEQAIRTFGKMTGKPHKMVILGDMYELGDNTVEEHK
KLGEWVSEYDIEKVCFTGELTQSALLKAPRALYFPDPFSLRNWLADSKLEDHLILIKGSR
GMKLEGLVEFI