Protein Info for Echvi_1879 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): L-arabinose isomerase (EC 5.3.1.4)
Rationale: Specifically important for utilizing L-Arabinose. Automated validation from mutant phenotype: the predicted function (ARABISOM-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: L-arabinose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF02610: AraA_N" amino acids 8 to 174 (167 residues), 288.8 bits, see alignment E=1.7e-90 PF24856: AraA_central" amino acids 177 to 324 (148 residues), 227.2 bits, see alignment E=1.7e-71 PF11762: Arabinose_Iso_C" amino acids 328 to 471 (144 residues), 226.1 bits, see alignment E=2e-71

Best Hits

Swiss-Prot: 62% identical to ARAA_HERA2: L-arabinose isomerase (araA) from Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)

KEGG orthology group: K01804, L-arabinose isomerase [EC: 5.3.1.4] (inferred from 70% identity to cpi:Cpin_3996)

MetaCyc: 57% identical to L-arabinose isomerase (Escherichia coli K-12 substr. MG1655)
L-arabinose isomerase. [EC: 5.3.1.4]

Predicted SEED Role

"L-arabinose isomerase (EC 5.3.1.4)" in subsystem L-Arabinose utilization (EC 5.3.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW63 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Echvi_1879 L-arabinose isomerase (EC 5.3.1.4) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNLKENEVWFITGSQHLYGPEALQQVAEHAQIIAEELNKSEKISVTTVFKPIVTTTEEI
YAAIQEANNAPNCIGVITWMHTFSPAKMWINGLKILQKPMLHLHTQYNQDIPWNSIDMDF
MNLNQSAHGDREFGFMTARMKVKRKVVVGHWKDEEVHSQIDVWARAASGWHDWQGAKFAR
FGDNMRFVAVTDGDKVEAELKFGFSVNTYAVGDLVAKIEAVSEGDLKALIEEYEATYTLS
EELQANGAKRQSLIDAAKIELGMRAFLEEGGFKGFSNTFEDLYGMKQLPGIATQRLMADG
YAYAGEGDWKTAALVRAMKVMGSGLEGGNAFMEDYTYHFDPNNSLVLGSHMLEVDPTLTT
EKISCEVHPLGIGGKEDPVRLVFNGAGGNGLNASIVDMGNRFRLIVNDVEAVKPLKDLPN
LPVARVMWKPMPDMKTGCAAWILAGGAHHTCFSQNLTSEHLNDFAVMAGIESVNIDKETT
LRGIQNELRWSDAYYHFNDK