Protein Info for Echvi_1864 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00356: LacI" amino acids 6 to 51 (46 residues), 52.2 bits, see alignment 8.1e-18 PF00532: Peripla_BP_1" amino acids 63 to 318 (256 residues), 91.6 bits, see alignment E=1.3e-29 PF13407: Peripla_BP_4" amino acids 65 to 313 (249 residues), 79 bits, see alignment E=8.5e-26 PF13377: Peripla_BP_3" amino acids 173 to 338 (166 residues), 94 bits, see alignment E=2.2e-30

Best Hits

Swiss-Prot: 32% identical to CCPA_BACME: Catabolite control protein A (ccpA) from Bacillus megaterium

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 60% identity to sli:Slin_0352)

Predicted SEED Role

"LacI family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW51 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Echvi_1864 Transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKDITIYDIAKNLGVSPTTVSRALNDHPAVNPKTKKRIFDAADQMGYQSNVFASNLRSK
RTNNIGIIVPRLNSSFQSSVLAGMEKVANEAGYNLIISQSLESYEKEKANARSMFNSRVD
GLLVSLAGDTDKTKHFQPFMDKGTPILFFDRVASQSGHTGVVIDNSQAGYNATQHLIQQG
CKNIIHVLGNLKINVYGERLKGYKYALMDHDIPFTQENILHSDLNEEAGEDIAHKILSMD
PLPDGLFVSNDACAASCIRSLKQAGIKIPEDIAVVGFNNDMISRLIEPNLTTTHYPGYEM
GEVAMKNLINHLTDNTEGVLHNTNTITLRSELIIRASSLKKKLEP