Protein Info for Echvi_1810 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: 3-dehydroquinate dehydratase, type II
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to AROQ_PROMT: 3-dehydroquinate dehydratase (aroQ) from Prochlorococcus marinus (strain NATL2A)
KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 66% identity to cpi:Cpin_2345)Predicted SEED Role
"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- chorismate biosynthesis I (7/7 steps found)
- chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
- gallate biosynthesis (2/3 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- quinate degradation I (1/3 steps found)
- quinate degradation II (1/3 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (4/42 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FW14 at UniProt or InterPro
Protein Sequence (139 amino acids)
>Echvi_1810 3-dehydroquinate dehydratase, type II (Echinicola vietnamensis KMM 6221, DSM 17526) MKILIINGPNLNLLGKREPEIYGSKSFEDFFGELETTFSNISLSYYQSNVEGELVNKIHE VGFTYDAILLNAGAYTHTSVAISDAIAGVTTPVMEIHISNIYKRETFRHKSIISKECIGM IAGLGLKGYALGIQYFLEN