Protein Info for Echvi_1746 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 10 to 306 (297 residues), 220.9 bits, E=7e-69
• PF02719: Polysacc_synt_2
  • amino acids 11 to 205 (195 residues), 57 bits, E=6.6e-19
• PF16363: GDP_Man_Dehyd
  • amino acids 12 to 300 (289 residues), 71.8 bits, E=2.5e-23
• PF01073: 3Beta_HSD
  • amino acids 12 to 162 (151 residues), 40.8 bits, E=5e-14
• PF01370: Epimerase
  • amino acids 12 to 233 (222 residues), 102.5 bits, E=8.7e-33
• PF13460: NAD_binding_10
  • amino acids 15 to 170 (156 residues), 42.4 bits, E=2.5e-14
• PF07993: NAD_binding_4
  • amino acids 76 to 175 (100 residues), 29.9 bits, E=1.1e-10

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 61% identity to mtt:Ftrac_2769)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

See L0FZ57 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Echvi_1746 dTDP-4-dehydrorhamnose reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNTPKKNKPTLLVTGANGLLGQKLVNRLLEKDSFHVIATGRGACRLPQTWEGFTYASMDI
TDKENVLEVFQRYSPEVVIHGAAMTNVDECETAQEACYQQNVAAVGNIIVAAEQYHSFLV
HVSTDFIFDGEAGPYTEDAVPNPVNYYGETKLQAEALIQQSSLNWGIARTVLVYGISHDM
SRSNIVLWVKKSLEEGKDLQLVDDQLRTPTLAEDLAEGCILMAEQRAKGVFNISGDELLT
PYDMAIQTAEFFKLDKTKINKTDSSAFRQTAKRPMKTGFVVQKAKDQLNFKPKSFTEGIE
ILAKQLNLAN