Protein Info for Echvi_1743 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: alpha-L-glutamate ligases, RimK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF18030: Rimk_N" amino acids 1 to 94 (94 residues), 134.9 bits, see alignment E=2e-43 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 3 to 287 (285 residues), 252.8 bits, see alignment E=2.1e-79 PF08443: RimK" amino acids 98 to 287 (190 residues), 218.2 bits, see alignment E=1.6e-68 PF02655: ATP-grasp_3" amino acids 99 to 264 (166 residues), 30.2 bits, see alignment E=9.2e-11 PF02955: GSH-S_ATP" amino acids 139 to 272 (134 residues), 67 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 65% identical to RIMK_ALIFM: Probable alpha-L-glutamate ligase (rimK) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 74% identity to mtt:Ftrac_1140)

MetaCyc: 57% identical to ribosomal protein S6 modification protein (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYB1 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Echvi_1743 alpha-L-glutamate ligases, RimK family (Echinicola vietnamensis KMM 6221, DSM 17526)
MRIAVLSRNPNLYSTRRLREAIIAAGHEALIIDHSLCDLVIEQEGPSIFYRGEKLSNIDA
IIPRIGASVTFYGTAVVRQFELMGVISAVESQAIVRSRDKLRSLQILSREGLGMPKTAFT
NFSKGGEKQLIDQVGGAPLIIKLLEGTQGLGVVLAETRKAGQSVIEAFHGLKARIIVQEF
IKEAKGADIRAFVVNGKVVGAMKRQGEEGEFRSNLHRGGKATVIKLSATERKAALGAAKA
LGLAVAGVDMLQSSRGPLILEVNSSPGLEGIEKATGVNIAGKIIQYIEETAQRKLSKRKI
KE