Protein Info for Echvi_1678 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted dehydrogenases and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF01408: GFO_IDH_MocA" amino acids 8 to 124 (117 residues), 82 bits, see alignment E=1.1e-26 PF03447: NAD_binding_3" amino acids 28 to 123 (96 residues), 32.3 bits, see alignment E=2.9e-11 PF22725: GFO_IDH_MocA_C3" amino acids 141 to 259 (119 residues), 30.7 bits, see alignment E=5.4e-11 PF02894: GFO_IDH_MocA_C" amino acids 170 to 346 (177 residues), 37.8 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 73% identity to shg:Sph21_2334)

Predicted SEED Role

"oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY17 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Echvi_1678 Predicted dehydrogenases and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKEGTLRLGILGLGEGRSTISAALNSQKIQLVQICDRNEALCKQRAKEFDFAHYTTRYE
DMLENSDIDAIGIYTPDKLHASHIKMAMEHGKHVVCTKPLLDDLKDAKELIDLQKKTGKR
LFVGQSSRFFEPMKRQRADYKKGLIGDLITVEAYYHADHRWFLEKPWALEPAFKWLYGGL
SHPVDFIRWYLPEIEEVMGYGMLSANGKQGGLKNPDTMHFIYKATDGRIARVSGAYTGPV
QPALRDSEMSCILRGTEGSSQGDYMELRYAITDNTGEEQVVTWEHKSKHYFRFEGKSHHA
GEYNNYLEHFADSINYDFVAYPDLIEGVGTIALLKTMEKSLASGKPEKVAEVIAEFGLED
YLKRG