Protein Info for Echvi_1659 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Farnesoic acid 0-methyl transferase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06439: 3keto-disac_hyd" amino acids 50 to 223 (174 residues), 30 bits, see alignment E=7.7e-11 PF19763: DUF6250" amino acids 72 to 230 (159 residues), 228.8 bits, see alignment E=5.2e-72 PF12248: Methyltransf_FA" amino acids 135 to 226 (92 residues), 32.5 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 52% identity to phe:Phep_2837)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVJ9 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Echvi_1659 Farnesoic acid 0-methyl transferase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MERLFLIFITGAFLASCGSSESNKTTASEVAASNKVLAAEDFSTPLDSARWKVEMDDLPN
SSVSVKDGKLVLDTKGGVTVWLNQKLKGNIEITYKRQVVVADGPNDRLSDLNQFWMATDP
RQENLFTRTGKFEEYDSLSMYYVGFGGNYNGTTRFREYQGNGVKTLLFDLDDEAHLLKPN
HWYTINIKVEDGVVSYWVDGEKFFEYTDETPLEEGYFGFRSTWSRHEIDELRVISLEI