Protein Info for Echvi_1643 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07470: Glyco_hydro_88" amino acids 38 to 372 (335 residues), 283.5 bits, see alignment E=1.2e-88

Best Hits

KEGG orthology group: None (inferred from 64% identity to sli:Slin_1806)

Predicted SEED Role

"Rhamnogalacturonides degradation protein RhiN" in subsystem D-Galacturonate and D-Glucuronate Utilization or L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXX8 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Echvi_1643 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MQIRRITAMLALLIFAASVSKAQELPTKEAVMDQMVLTNQYFMEKWPDPGQNVITNKERT
SNLWTRAVYYEGLMALYGLKPDKAYYDYAVKWGASHGWDLRNGTQTRHADNHCAGQTYIM
LYEIDQQPERIEHIQSSIDGMMDTYKINDWDWIDALQMAMPVFAQLTSLTGDAKYSERMY
EMYMDTKVTQGLFNPHDDLWWRDSDFRPPYAEPNGNDCYWSRGNGWVVAAMVRTLEFLPA
DDPHRFEYVQMLQRMLKAVLPVQRTDGFWNVSLHDPTHFEGKETSGTALFLYGMAWGVNN
GLLEKEVYMPAIKKAWNAIASESIHDNGFLGYLQGTGKEPKDGQPVTYTSKPDFEDYGLG
CFLLAATEMYKLVD